Protein Info for Pf1N1B4_3999 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF12802: MarR_2" amino acids 36 to 95 (60 residues), 53.9 bits, see alignment E=2.5e-18 PF01047: MarR" amino acids 38 to 96 (59 residues), 60.2 bits, see alignment E=2.2e-20 PF13463: HTH_27" amino acids 56 to 104 (49 residues), 28 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 42% identical to MARR_ECOLI: Multiple antibiotic resistance protein MarR (marR) from Escherichia coli (strain K12)

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 88% identity to pfl:PFL_3919)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PQB1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Pf1N1B4_3999 Transcriptional regulator, MarR family (Pseudomonas fluorescens FW300-N1B4)
MKHFTPENFQHCHLGLLLGRAALLKDRIIDTHMAPHGITAAQFKVLIIMAQFGVDTPAEL
CRHLSLDSGSMTRMLDRLEQKGFLARQRSEADRRQVQLVLTEQGQQLTDQLPQIGADAMN
ELAGAITPQELKTLEQILKKILVAAGDSITLLRVGGHEQ