Protein Info for Pf1N1B4_3922 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lipoprotein releasing system transmembrane protein LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 295 to 323 (29 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 1 to 394 (394 residues), 526.9 bits, see alignment E=1.8e-162 PF12704: MacB_PCD" amino acids 5 to 175 (171 residues), 62.9 bits, see alignment E=5.4e-21 PF02687: FtsX" amino acids 254 to 387 (134 residues), 69.9 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 46% identical to LOLC_NEIMA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 92% identity to pfo:Pfl01_3859)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PN48 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Pf1N1B4_3922 Lipoprotein releasing system transmembrane protein LolC (Pseudomonas fluorescens FW300-N1B4)
VSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVLGMVPHATIESGEPISDWQSLAA
KVKQNPQVAAVAPFVQMQGLLTNNGKVSKVLLNAIDPVQERQVSIIDNFMQQGKLDDLAP
GSFGIVIGDKAAAKLGVAVGDKLTFVAPEVTVTPAGMFPRMKRFTVVGIFHVGAGEIDGY
LGITNLQDLAKLHRWQPDQVQGLRLKFDDLFQAPRMAWTIAQQLGEDTYYARDWTRTHGN
LYQAIRMEKAMIGLLLLLIVAVAAFNIISTLVMVVNDKKGDIAILRTLGSTPGQIMAIFM
VQGTVIGVVGTLIGAVVGIFAALNVSAAISALEGLIGHKFLNADVYFIDYLPSQVQSQDV
LMVCAAALVLSFLATLYPAWRAARTQPAEALRYE