Protein Info for Pf1N1B4_3873 in Pseudomonas fluorescens FW300-N1B4

Annotation: Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 1 to 409 (409 residues), 569.8 bits, see alignment E=2.1e-175 PF13746: Fer4_18" amino acids 158 to 263 (106 residues), 151.9 bits, see alignment E=2.2e-48 PF11614: FixG_C" amino acids 294 to 409 (116 residues), 106.4 bits, see alignment E=3.2e-34

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_1818)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>Pf1N1B4_3873 Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation (Pseudomonas fluorescens FW300-N1B4)
LNWGGHQAVWWNLPERKFFIFGATFWPQDFILLSGILIISAFGLFFITVYAGRVWCGYTC
PQSVWTWIFMWCEKVTEGDRNQRIKLDKAPMSANKFLRKFSKHTMWLLIGFVTGMTFVGY
FSPIRELVLDFFTGQADGWSYFWVGFFTLATYGNAGWLREQVCIYMCPYARFQSVMFDKD
TLIVSYDPRRGESRGPRKKGIDYKAQGLGDCIDCTMCVQVCPTGIDIRDGLQVECIGCAA
CIDACDSIMDKMDYPRGLISYTTEHNLSGQKTHKLRPRLIGYATVLLAMIALLMTAFFMR
SLVGFDVSKDRVLYRENAEGRIENVYSLKIMNKDQRDHTYVLEATGLPDLKLQGKREIKV
AAGEIFSQPVELSSAPEQLPSSTNEVKFILKDADDANVHVEAKSRFIGPQIR