Protein Info for Pf1N1B4_3851 in Pseudomonas fluorescens FW300-N1B4

Annotation: XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF02625: XdhC_CoxI" amino acids 15 to 80 (66 residues), 68.4 bits, see alignment E=4.2e-23 TIGR02964: xanthine dehydrogenase accessory protein XdhC" amino acids 22 to 252 (231 residues), 326.1 bits, see alignment E=7.5e-102 PF13478: XdhC_C" amino acids 110 to 251 (142 residues), 120.4 bits, see alignment E=6.8e-39

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 92% identity to pfo:Pfl01_1795)

Predicted SEED Role

"XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZB55 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Pf1N1B4_3851 XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase) (Pseudomonas fluorescens FW300-N1B4)
VKNMYNWIDALADLQARGEPCVLVTIIEELGSTPRNAGSKMVISAAQTFDTIGGGHLEYK
AMQIGREMLASGRQDTHLERFSLGASLGQCCGGVTVLLFEPMGQVQAQIAVFGAGHVGRA
LVPLLASLPCRVRWIDSREAEFPDQIPHGVRKIVTEEPLDEVDDLPAGSYCIVMTHNHQL
DLELTAAILKRNDFAYFGLIGSKTKRVKFEHRLRDRGFDSTVLQRMRCPMGIGEVKGKLP
VEIAISIAGEIIATYNANFGQHTASAGSSIAKLLPASRRSQALN