Protein Info for Pf1N1B4_3799 in Pseudomonas fluorescens FW300-N1B4

Annotation: 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details TIGR00530: 1-acylglycerol-3-phosphate O-acyltransferases" amino acids 64 to 181 (118 residues), 145.3 bits, see alignment E=4.1e-47 PF01553: Acyltransferase" amino acids 67 to 181 (115 residues), 125 bits, see alignment E=9.3e-41

Best Hits

KEGG orthology group: K00655, 1-acyl-sn-glycerol-3-phosphate acyltransferase [EC: 2.3.1.51] (inferred from 95% identity to pfo:Pfl01_1743)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PKD6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Pf1N1B4_3799 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) (Pseudomonas fluorescens FW300-N1B4)
MLFVFRMLLMGLHFILAGMLGVILGLCRPFNPDNSRLCARLYAWPAMCILRLRVKADVGP
LMDKPDSCVIIANHQSNYDLFVFGNVVPRRTVCIGKKSLKWVPLFGQLFWLAGNVLIDRG
NAHKARQSMLTTTRTLQHEDTSIWVFPEGTRNLGEELLPFKKGAFQMAIAAGVPIVPVCV
SSYVKHMRLNRWRSGKILIRSLPAIPTAGLSLDDMPMLIAQCREQMRECIDSMDRQLQAA