Protein Info for Pf1N1B4_3785 in Pseudomonas fluorescens FW300-N1B4

Annotation: FOG: Ankyrin repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF13637: Ank_4" amino acids 24 to 69 (46 residues), 28.5 bits, see alignment E=3.7e-10 amino acids 55 to 102 (48 residues), 37.4 bits, see alignment E=5.7e-13 amino acids 89 to 135 (47 residues), 31.2 bits, see alignment E=5.3e-11 amino acids 119 to 157 (39 residues), 26.5 bits, see alignment 1.6e-09 PF12796: Ank_2" amino acids 24 to 108 (85 residues), 55.2 bits, see alignment E=2.1e-18 amino acids 73 to 145 (73 residues), 52.7 bits, see alignment E=1.4e-17 amino acids 89 to 162 (74 residues), 44.3 bits, see alignment E=5.7e-15 PF13857: Ank_5" amino acids 35 to 86 (52 residues), 34.1 bits, see alignment E=6.9e-12 PF00023: Ank" amino acids 49 to 80 (32 residues), 35.1 bits, see alignment 2.5e-12 amino acids 114 to 145 (32 residues), 34.3 bits, see alignment 4.7e-12 PF13606: Ank_3" amino acids 49 to 76 (28 residues), 23.1 bits, see alignment 1.7e-08 amino acids 114 to 142 (29 residues), 29.5 bits, see alignment 1.3e-10

Best Hits

Swiss-Prot: 56% identical to Y3287_PSEAE: Putative ankyrin repeat protein PA3287 (PA3287) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06867, (no description) (inferred from 95% identity to pba:PSEBR_a4167)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AT70 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Pf1N1B4_3785 FOG: Ankyrin repeat (Pseudomonas fluorescens FW300-N1B4)
MSDKSRQMTPEEAAEFAEQVFNKAREGDAAMMAALLTKGLPPNLRNHKGDTLLMLAAYHG
HVETVKVLLEHKADPEIRNDNGQSPIAGAAFKGDLAVVKALVEGGAQVEGSSFDGRTALM
MAAMFNRVEIVDYLISKGADPKAKDANGVSALDAAKTMGAVDTTAQLQKLLA