Protein Info for Pf1N1B4_3779 in Pseudomonas fluorescens FW300-N1B4

Annotation: Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12146: Hydrolase_4" amino acids 80 to 281 (202 residues), 41.6 bits, see alignment E=9.3e-15 PF12697: Abhydrolase_6" amino acids 81 to 283 (203 residues), 34.9 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 90% identity to pba:PSEBR_a4172)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PJV6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Pf1N1B4_3779 Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase (Pseudomonas fluorescens FW300-N1B4)
MMLRVLALSLTLFTGLLPYVAQATVLQRPITLDTGSGELFGSLLLPKSDTPVPVVLIISG
SGPTDRDGNNPDGGRNDSLKRLAWVLAKHNIASVRYDKRGVAASLAATPDERNLSVEAYV
ADAQAWGHKLKTDPRFGKLILLGHSEGALIASLAAPNIDAAAVISLSGSARPIDQVLRQQ
LSNRLPPPLMLRSNELLDSLKAGHTDDNVPPQLQVIFRPSVQPYLISLFRQDPAAAFAKL
KMPALIIQGSNDIQVGVGDAKALKAAKPDAELALIEGMNHVMRIVPNDVKRQLASYKDPQ
LPLAAELGARILEFIDGLRTR