Protein Info for Pf1N1B4_3769 in Pseudomonas fluorescens FW300-N1B4

Annotation: Xanthine/uracil/thiamine/ascorbate permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 309 to 324 (16 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 395 to 421 (27 residues), see Phobius details amino acids 431 to 448 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 38 to 411 (374 residues), 173.5 bits, see alignment E=3e-55

Best Hits

Swiss-Prot: 50% identical to ADEP_ECOLI: Adenine permease AdeP (adeP) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 96% identity to pba:PSEBR_a4182)

MetaCyc: 50% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PJJ4 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf1N1B4_3769 Xanthine/uracil/thiamine/ascorbate permease family protein (Pseudomonas fluorescens FW300-N1B4)
VESRKSEAPTLELSPPLRNGWLERIFKLSLHGTTVKTELIAGLTTFITMAYIIFVNPNIM
ADAGIDHGAAFVATCIAAALGCLLMGLYANWPVGLAPGMGLNAFFTYTVVGTMGYNWETA
LGAVFVSGVLFMFLTFSRIREWLLNSIPVSLRFAMGAGVGLFLGLIGLKTAGIVVDSPAT
LIKLGSLREPGPLLAAICFLMIAVLSYHKVFGAILISIITVTLAGWGLGLVHYEGIMSAP
PSLAPTWMAMDVAGVFNISMISVVLAFLFVHMFDTAGTLMGVAQRAGLVNADGKIENLSR
ALKADSASSVFGAVVGVPPVTSYVESAAGVAAGGRTGLTAVTVGVLFIAAMFFAPLAGMI
PAYATAGALIYVAMLMMGGMAHIEWDEATDSIPAIVTAIMMPLTFSVADGIALGFITYVV
LKAFTGKHKEISVSLWVLCAIFIAKFIFL