Protein Info for Pf1N1B4_3767 in Pseudomonas fluorescens FW300-N1B4

Annotation: 5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR02962: hydroxyisourate hydrolase" amino acids 1 to 109 (109 residues), 116 bits, see alignment E=5.7e-38 PF00576: Transthyretin" amino acids 1 to 108 (108 residues), 113.7 bits, see alignment E=3.1e-37

Best Hits

Swiss-Prot: 80% identical to HIUH_PSEAE: 5-hydroxyisourate hydrolase (PA1518) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 95% identity to pfo:Pfl01_1708)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PJH7 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Pf1N1B4_3767 5-Hydroxyisourate Hydrolase (HIUase) (EC 3.5.2.17) (Pseudomonas fluorescens FW300-N1B4)
LDAAHGCPGSSIKVELYRVEGSLLELVATALTNSDGRVDSPLLQGDDYRSGVYQLQFHAG
DYYRARGVQLPEPAFLDVVVLRFGISAEQDHYHVPLLISPYSYSTYRGS