Protein Info for Pf1N1B4_3726 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 327 to 355 (29 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 411 to 433 (23 residues), see Phobius details

Best Hits

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>Pf1N1B4_3726 Sensory box histidine kinase/response regulator (Pseudomonas fluorescens FW300-N1B4)
MSLSIGLIATVALAYMAILFAIAFYGDRRSTPLPPRMRAWVYSLSLAVYCTSWTFFGAVG
QAAEQLWSFLPIYLGPILLLVCAPWVLQKMVMISKQENITSIADFIAARYGKSQSLAVVV
ALICLVGVLPYIALQLKGIVLGVNLLIGAGADAMGTRAQDTALIVSLVLALFTIVFGTRN
LDATEHHRGMVLAIAFESLVKLFAFLAVGAFVTYGLYDGFDDLFDQAMLAPRLEAYWKET
INWPSMVVQTGVAMMAIICLPRQFHVTVVENIDPQDLRLAKWVFPAYLALAALFVVPIAL
AGQMMLPSSVLPDSFVISLPLAESHPALAMLAFIGGASAATGMVIVASVALSTMLSNDML
LPWLLRRNNAERPFEVFRQWMLSVRRVSIVVILLLAYVSYRLLGSTASLATIGQIAFAAV
TQLAPAMLGALYWKQANRRGVFAG