Protein Info for Pf1N1B4_3715 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 179 to 208 (30 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 4 to 239 (236 residues), 121.1 bits, see alignment E=3.3e-39 PF02654: CobS" amino acids 7 to 238 (232 residues), 183.2 bits, see alignment E=3.6e-58

Best Hits

Swiss-Prot: 84% identical to COBS_PSEPF: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 84% identity to pfo:Pfl01_1650)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PID7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Pf1N1B4_3715 Cobalamin synthase (Pseudomonas fluorescens FW300-N1B4)
MLPFWIALQFLSSLPIRLPGMPTPEELGRSLLFYPLVGLLFGVILWGLNWLLLGAPLLLH
AALLLSVWVVLSGALHLDGLADSADAWLGGYGDRERTLTIMKDPRSGPIAVVTLVLVLLL
KFAALLALIEQQHSVILIIVPLLGRSALLGLFLTTPYVRPGGLGQALADHLPRLAGKQVL
AISALACVLMAGFSAVWALALAAAMFVWLRQVMVRRLGGTTGDTAGALLELLEVAVLVGV
ALL