Protein Info for Pf1N1B4_3712 in Pseudomonas fluorescens FW300-N1B4

Annotation: Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02283: CobU
  • amino acids 4 to 172 (169 residues), 204.8 bits, E=3.5e-65

Best Hits

Swiss-Prot: 71% identical to COBP_PSEAE: Bifunctional adenosylcobalamin biosynthesis protein CobP (cobP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02231, adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC: 2.7.1.156 2.7.7.62] (inferred from 90% identity to pfo:Pfl01_1647)

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.7.62

Sequence Analysis Tools

See A0A166PIB9 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf1N1B4_3712 Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62) (Pseudomonas fluorescens FW300-N1B4)
MLQLILGGARSGKSRLAEKLATDSQLQVTYIATYIATSQSQDGEMNERVAHHRARRPAEW
ALIEEPLELARVLRETASADRCLLVDCLTLWLTNLLMLDDAERLSAEREALLDCLASLPG
EIIFVSNETGMGVVPLGELTRRYVDEAGWLHQALAERCQRVVLTVAGLPLTLKGTAL