Protein Info for Pf1N1B4_3707 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cobyrinic acid A,C-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 10 to 427 (418 residues), 261.8 bits, see alignment E=5.9e-82 PF01656: CbiA" amino acids 11 to 188 (178 residues), 49.7 bits, see alignment E=3.7e-17 PF07685: GATase_3" amino acids 240 to 421 (182 residues), 108.3 bits, see alignment E=4.1e-35

Best Hits

Swiss-Prot: 75% identical to COBB_PSEU5: Hydrogenobyrinate a,c-diamide synthase (cobB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 89% identity to pba:PSEBR_a4244)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162ASB9 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Pf1N1B4_3707 Cobyrinic acid A,C-diamide synthase (Pseudomonas fluorescens FW300-N1B4)
MNSHRQCPAVLIAAPASGQGKTTVTAALARLHRNQGRKVRVFKCGPDFLDPMILERASGA
PVYQLDMWMVGEQESRRLLWEAAGEADLILIEGVMGLFDGTPSSADLARHFGVPVLGVID
GTAMAQTFGALALGLARYQPDLPFAGVLANRVGTVRHAQLLEGSLTEGLRWYGALSRETG
IELPSRHLGLVQASELNDLDLRLDAAAESLASSCDVALPPAVEFAAPEMIAAEPLLAGVR
IAVARDEAFAFTYGASLDLLRAMGAELTFFSPIRDSELPEADSLYLPGGYPELHHVALSQ
NTPMLTAIRAHHAAGKPLLAECGGMLYLLDSLTDVEGTRAELVGLLAGEAVMQKRLAALA
LQAVELPEGLLRGHTYHHSLTSTDLEPIARGLSPNGGRGAEAVYREGRMTASYVHFYFPS
NPSAIAALFVPDLEDAFASKPAPTGECNSNVGAGLLAKRP