Protein Info for Pf1N1B4_3643 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cytochrome c-type biogenesis protein CcmE, heme chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF03100: CcmE" amino acids 34 to 131 (98 residues), 120.9 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 97% identical to CCME1_PSEPF: Cytochrome c-type biogenesis protein CcmE 1 (ccmE1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 97% identity to pfo:Pfl01_1581)

MetaCyc: 46% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AQG0 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Pf1N1B4_3643 Cytochrome c-type biogenesis protein CcmE, heme chaperone (Pseudomonas fluorescens FW300-N1B4)
VNPLRKKRLIIILAILVGVGAAVGLALSALQQNINLFYTPTQIANGEAPQDTRIRAGGMV
EKGSLQRSGDSLDVKFIVTDFNKSVTISYRGILPDLFREGQGIVALGKLNADGVVVADEV
LAKHDEKYMPPEVTKALKDSGQSAPTPAKEG