Protein Info for Pf1N1B4_362 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 292 to 318 (27 residues), see Phobius details PF00664: ABC_membrane" amino acids 72 to 322 (251 residues), 96.2 bits, see alignment E=2.8e-31 PF00005: ABC_tran" amino acids 384 to 532 (149 residues), 108 bits, see alignment E=6.2e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 92% identity to pfo:Pfl01_4088)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XMB8 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Pf1N1B4_362 Lipid A export ATP-binding/permease protein MsbA (Pseudomonas fluorescens FW300-N1B4)
VHDLPDDVPAPARVDRLSWAEIRRLALHHKKSLWIANGVAVLATLCSVPIPLLLPLLVDE
VLLGHGDAALKIMNHALPDVWQKAAGYIGLMLLVTLALRCAALLFNVVQAKLFAALAKDI
VYRIRVRLIERLKCISLGEYESLGSGTVTTHLVTDLDTVDKFVGETLSRFLVAMLTLVGT
ASILMWMHWKLALLILLFNPLVIYATVQLGKRVKHLKKLENDSTSRFTQALTETLDAIQE
VRAGNRQGFFLGRLGQRAREVRDYAVSSQWKTDASNRASGLLFQFGIDIFRAAAMLTVLF
SDLSIGQMLAVFSYLWFMIGPVEQLLNLQYAFYAAGGALSRINELLARADEPQYNGSVDP
FQGRDTVGIEVQGLSFGYGDELVLNQMNLSIAPGEKVAIVGASGGGKSTLVQLLLGLYTP
LAGTIRFGGSTQEEIGLETVRENVAVVLQHPALFNDTVRANLTMGRERSDEACWQALEIA
QLHNTVRELPNGLDSIVGRSGVRLSGGQRQRLAIARMVLAEPKVVILDEATSALDAATEY
NLHQALARFLSHRTTLIIAHRLSAVKQADRVLVFDGGQVAEDGDHQQLIADGGLYAKLYG
HLQQH