Protein Info for Pf1N1B4_3610 in Pseudomonas fluorescens FW300-N1B4

Annotation: Serine phosphatase RsbU, regulator of sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 85.8 bits, see alignment E=3.6e-28 PF07228: SpoIIE" amino acids 194 to 381 (188 residues), 135.6 bits, see alignment E=3.1e-43 PF13581: HATPase_c_2" amino acids 488 to 557 (70 residues), 30.3 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_1542)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZAL9 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Pf1N1B4_3610 Serine phosphatase RsbU, regulator of sigma subunit (Pseudomonas fluorescens FW300-N1B4)
MQPLEPLTILIAEDSAADRMLLSTIVRRQGHEVLTAANGAEAVEAFRSQRPHLVLMDAMM
PVMDGFEAAQQIKALAGETLVPIIFLTSLTESEALARCLEAGGDDFLAKPYNQVILAAKV
KAMDRLRRLQATVLEQRDLIARHHDYLLNEQRVAKAVFDKVAHSGCLNAPNIRYLQSPYA
LFNGDLLLAAFTPAGDMHVLLGDFTGHGLPAAVGAMPLAEVFYGMTAKGYGLSETLREMN
AKLKRILPVDMFCCAALLCLSFQRGSVEVWNGGMPDGYLHSIASGERTVLTARHLPLGVL
SSQTFDDRTEVFPMAVGDRVFLLSDGVIDTCDANEQLFGVERLEQVFAANRQPDALFEEI
EQALRDFRGEARDDVSMVEVRLLEAAQLSPPTPVYSDSGQSCPLDWSVSFEFRAATLKRF
NPLPYLLQLLLEVHGLRAQSGALYSVLAELYSNALEHGVLGLDSSLKRDAAGFARYYQQR
NARLDELRDGYVRVHLQVTPKGEGGCLVIRVEDSGKGFDVARVMARPVDDVRLSGRGVNL
IRQLSDHATWSDNGRSARVEFFWEALA