Protein Info for Pf1N1B4_3605 in Pseudomonas fluorescens FW300-N1B4

Annotation: Flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00207: flagellar motor switch protein FliG" amino acids 9 to 337 (329 residues), 342.4 bits, see alignment E=1.6e-106 PF14842: FliG_N" amino acids 10 to 111 (102 residues), 120.4 bits, see alignment E=9.6e-39 PF14841: FliG_M" amino acids 121 to 194 (74 residues), 84.7 bits, see alignment E=8.7e-28 PF01706: FliG_C" amino acids 224 to 330 (107 residues), 143.9 bits, see alignment E=4.4e-46

Best Hits

Swiss-Prot: 90% identical to FLIG_PSEAE: Flagellar motor switch protein FliG (fliG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 98% identity to pba:PSEBR_a1479)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4SNT3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Pf1N1B4_3605 Flagellar motor switch protein FliG (Pseudomonas fluorescens FW300-N1B4)
MSDNRAVAAKLTKVDKAAILLLSLGSTDAAQVLRHMGPKEVQRVGVAMAQMGNVHREQVE
QVMSEFVDIVGDQTSLGVGSDDYVRKMLTQALGEDKANGLIDRILLGGNTSGLDSLKWME
PRAVADVIRYEHPQIQAIVVAYLDPDQAGEVLGNFDHKVRLDIILRVSSLNTVQPAALKE
LNQILEKQFSGNSNASRTTLGGIKRAADIMNFLDSSIEGQLMDSIREVDEDLSGQIEDLM
FVFNNLSDVDDRGIQALLREVSSDVLVLALKGSDEGVKEKIFKNMSKRAAELLRDDLEAK
GPVRVSDVETAQKEILTIARRMAEAGEIVLGGKGGEEMI