Protein Info for Pf1N1B4_3603 in Pseudomonas fluorescens FW300-N1B4

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02049: FliE
  • amino acids 26 to 109 (84 residues), 109.5 bits, E=3.6e-36
• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 35 to 108 (74 residues), 89.8 bits, E=7.7e-30

Best Hits

Swiss-Prot: 89% identical to FLIE_PSEPF: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 94% identity to pba:PSEBR_a1477)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

See A0A0F4SNW0 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Pf1N1B4_3603 Flagellar hook-basal body complex protein FliE (Pseudomonas fluorescens FW300-N1B4)
MSQGIEFNRLMLDMRSMQMDAMSAPKSTAAVPELGGSSFSDMLGQAVNKVNDTQQASNQL
ASAFEIGKSGVDLTDVMISSQKASVSFQALTQVRNKLVQAYQDIMQMPV