Protein Info for Pf1N1B4_3600 in Pseudomonas fluorescens FW300-N1B4

Annotation: Flagellar sensor histidine kinase FleS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF13188: PAS_8" amino acids 79 to 136 (58 residues), 37.9 bits, see alignment E=2.8e-13 PF00989: PAS" amino acids 80 to 118 (39 residues), 29.4 bits, see alignment 1.8e-10 PF00512: HisKA" amino acids 186 to 249 (64 residues), 47.3 bits, see alignment E=4.5e-16 PF02518: HATPase_c" amino acids 293 to 395 (103 residues), 85.7 bits, see alignment E=7.4e-28 PF13589: HATPase_c_3" amino acids 297 to 344 (48 residues), 26.1 bits, see alignment 2e-09

Best Hits

KEGG orthology group: K10942, two-component system, sensor histidine kinase FlrB [EC: 2.7.13.3] (inferred from 92% identity to pfo:Pfl01_1533)

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PEU1 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Pf1N1B4_3600 Flagellar sensor histidine kinase FleS (Pseudomonas fluorescens FW300-N1B4)
MPQAAQMSPALDASGQPSSVEQASRLGLEQAFALFSQMSSQLTDSYSMLEARVTELKGEL
AVVSAQRMQELAEKERLANRLQNLLDLLPGGVIVIDAQGIVREANPAASELLGLPLEGEL
WRHVIARCFAPREDDGHEISLKDGRRLSIATRSLDAEPGQLVLLNDLTETRHLQDQLARH
ERLSSLGRMVASLAHQIRTPLSAALLYASHLTEQQLPVETQQRFAGRLKERLHELEHQVR
DMLVFARGELPLTDRVTPRMLMQSLQAAALTHVQDLPIRWQCDSHAGELLCNRDTLVGAI
LNLIENAIQASAGDVRLKVHLYTRGNNLRLCISDSGSGIDTKVLARLGEPFFTTKTTGTG
LGLTVVKAVARAHQGELQLRSRPGRGTCAQVILPLFSGEQPSAQGAK