Protein Info for Pf1N1B4_3591 in Pseudomonas fluorescens FW300-N1B4

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 274 to 291 (18 residues), see Phobius details PF08545: ACP_syn_III" amino acids 93 to 170 (78 residues), 72.1 bits, see alignment E=2.9e-24 PF08541: ACP_syn_III_C" amino acids 206 to 290 (85 residues), 83.6 bits, see alignment E=9.3e-28

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 94% identity to pfo:Pfl01_1524)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AXL2 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Pf1N1B4_3591 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41) (Pseudomonas fluorescens FW300-N1B4)
VDNYAQGAKFEKDEEFILGKIGSAFLPRKDAGQETSDLCVEAVNALFANNPDLKREAIDV
LIVVTQNGDEEGLPHTAAIVQDKLGLPTTVAAFDISLGCSGYVYGIYAIKGFMEAAGLKN
GLLVTADPYSKIVDPEDRNTTMLFGDAATATWMGEDAPWQLGKAKFGTDGSGAPHLKVSD
GVFFMNGRQVFNFALLKVPAHLHELLADSGLTADDIDAFCIHQGSAAIVDAVARRFEGEP
EKFIKDMVETGNTVSSSIPLLLEKHVLDSKWKRVALSGFGVGLSWGSAIIYRP