Protein Info for Pf1N1B4_3587 in Pseudomonas fluorescens FW300-N1B4

Annotation: N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF02348: CTP_transf_3" amino acids 4 to 132 (129 residues), 98 bits, see alignment E=7.3e-32 TIGR03584: pseudaminic acid cytidylyltransferase" amino acids 4 to 221 (218 residues), 328.8 bits, see alignment E=8.1e-103 PF12804: NTP_transf_3" amino acids 6 to 133 (128 residues), 34.7 bits, see alignment E=2.1e-12

Best Hits

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 85% identity to pfo:Pfl01_1521)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.43

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PEM2 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Pf1N1B4_3587 N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43) (Pseudomonas fluorescens FW300-N1B4)
LSSVAIIPARGGSKRIPRKNLKPFDGVPMIVRSIRTALASNLFDQVIVSTDDEEIAEVAR
ANGAQVPFMRPAALADDFTGTAAVIVHALKQLPPFDYACCVYATAPLLQARYLRQGHELL
VQHPDKSFTFSVAGFGFPVQRALTLDEQGALTSLYPEFREIRSQDLPEAFQDAGQFYWGR
SEAWLRGDVLFSPASLPVILPRHLVQDIDTLEDWTRAEYLYCALKAGGELQ