Protein Info for Pf1N1B4_3566 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phenylalanine-4-hydroxylase (EC 1.14.16.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to PH4H_PSEAE: Phenylalanine-4-hydroxylase (phhA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00500, phenylalanine-4-hydroxylase [EC: 1.14.16.1] (inferred from 96% identity to pfo:Pfl01_1499)

Predicted SEED Role

"Phenylalanine-4-hydroxylase (EC 1.14.16.1)" in subsystem Aromatic amino acid degradation or Pterin biosynthesis (EC 1.14.16.1)

MetaCyc Pathways

L-phenylalanine degradation I (aerobic) (1/1 steps found)
L-tyrosine biosynthesis IV (1/1 steps found)
L-phenylalanine degradation V (2/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.16.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZAI6 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Pf1N1B4_3566 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Pseudomonas fluorescens FW300-N1B4)
MKQTQYVAREPDAQGFIDYPAEEHAVWNTLITRQLKVVEGRACQEYLDGIEKLGLPHDRI
PQLGEINKVLGETTGWQVARVPALIPFQTFFELLANKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLQASKEERVYLARLYWMTIEFGLVDTPQGLRIYG
GGILSSPKETVYCLSNEPEHQAFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM
GMVKQGMQLGLRAPKFPPKAA