Protein Info for Pf1N1B4_3537 in Pseudomonas fluorescens FW300-N1B4

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details PF00892: EamA" amino acids 12 to 136 (125 residues), 45.7 bits, see alignment E=3.7e-16 amino acids 148 to 279 (132 residues), 76 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_1473)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z5T6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Pf1N1B4_3537 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N1B4)
MTPRTALGALHIGALMFGLTGVFGKLAAASPAIIVFGRAAFAVLALAFFARFASGTRWQK
LDAVDLRRLLLSGLLLMGHWVSFFIAVKVAGVAIATLGFASFPAFTVVLEGLIFRERIRA
NEILLVVLVSIGLVLVTPDFDLASGATTGLLWAVASGLLFALLSLTNRASSGRIPPVQAA
LCQNVVVAICLLPVAVPQLSEVRAIDWLWIGLLGVFCTGVAHSLFVASLAVIKARTASVV
FALEPVYGITLAWLLFDENPTLRMLIGGALIIVAIVVSSRLSGSSSKSAVAAQAPSH