Protein Info for Pf1N1B4_3478 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcriptional regulatory protein RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 87.5 bits, see alignment E=6.8e-29 PF00486: Trans_reg_C" amino acids 155 to 230 (76 residues), 85.4 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 40% identical to MPRA_MYCVP: Response regulator MprA (mprA) from Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

KEGG orthology group: K07661, two-component system, OmpR family, response regulator RstA (inferred from 90% identity to pfo:Pfl01_4245)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PBQ4 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Pf1N1B4_3478 Transcriptional regulatory protein RstA (Pseudomonas fluorescens FW300-N1B4)
VEQEVWQVLIVEDDQRLAELTRDYLEANGLRVSIEGDGALAAARIIKEKPDLVILDLMLP
GEDGLSICRKVRDKYDGPILMLTARSDDTDQILGLDLGADDYVCKPVRPRLLLARIQALL
RRSETPEAAPEKQRRLQFGPLVVDNALREAWLHDKGIELTSAEFDLLWLLVANAGRILSR
EEIFTALRGIGYDGQDRSIDVRISRIRPKIGDDPEHPRLIKTIRSKGYLFVPEACADLSL