Protein Info for Pf1N1B4_3447 in Pseudomonas fluorescens FW300-N1B4

Annotation: Succinylglutamate desuccinylase (EC 3.5.1.96)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR03242: succinylglutamate desuccinylase" amino acids 6 to 328 (323 residues), 389.1 bits, see alignment E=8.4e-121 PF24827: AstE_AspA_cat" amino acids 49 to 238 (190 residues), 202.1 bits, see alignment E=6.5e-64 PF04952: AstE_AspA_hybrid" amino acids 256 to 329 (74 residues), 72.1 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 95% identical to ASTE_PSEPF: Succinylglutamate desuccinylase (astE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 95% identity to pfo:Pfl01_4279)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z5M8 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Pf1N1B4_3447 Succinylglutamate desuccinylase (EC 3.5.1.96) (Pseudomonas fluorescens FW300-N1B4)
MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG
NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIRRGERFIEQDVNRLFNGRHEQTS
GSEALRACELERLAATFFSLPDRNRLHYDLHTAIRGSKIEQFALYPWKEGRQHSRLELAR
LRAAGMEAVLLQNKPSIVFSSYTYDKLDAESFTLELGKARPFGQNDGVNVSLLETRLKQI
IEGTEPPMTDDGLDGLQLFSVAREVIKHSDSFRLNLPTDIENFSELKVGYVLAEDIANTR
WVIEEKGARIIFPNPKVKNGLRAGILIVPTTDENLA