Protein Info for Pf1N1B4_3421 in Pseudomonas fluorescens FW300-N1B4

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF01925: TauE" amino acids 7 to 269 (263 residues), 129.1 bits, see alignment E=1.1e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 89% identity to pba:PSEBR_a4334)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BQ18 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Pf1N1B4_3421 Integral membrane protein (Pseudomonas fluorescens FW300-N1B4)
MFFYLLLALFGCMTGVTAVLFGFGGGFVVVPLLYRMLTASHGADDPISQSAMHIAVATST
CVMIVNALIASAKHHRAGNLIRHYLWPLGGFIGLGAIIGAVAAMWASGELIRFAFIAYLG
VTILDCLFRRGFLTQSDAVIPRRLGRAEVSGGGVGIGTIATFLGVGGSVMTVPLLRRCGL
SMSKATSMANPLSLPVAVAGTLTYMAMAGFAGFDLGRWFVGYVDVLAFAVLTVGSLVGIR
LATSWIGRIPDRVHARVYIGLLVVVMLSMAMK