Protein Info for Pf1N1B4_3407 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sterol desaturase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 111 to 244 (134 residues), 81.6 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: None (inferred from 73% identity to pfl:PFL_4541)

Predicted SEED Role

"Sterol desaturase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PAE5 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Pf1N1B4_3407 Sterol desaturase, putative (Pseudomonas fluorescens FW300-N1B4)
MKYIFARIYAPAFWGGFIGASLWLTGVAGLREGWLLPLFLAALALSFLAEWALPYEVCWN
RSVGDRARDIVHGLVNEALNALGLLALPGLVALLSFDGAWPRGWPLWLQLALAIFIADAG
LSLMHYASHRVQWLWRLHAVHHSVQRLYGFNGLMKHPLHQLLEASAGLLPLLLLGIPLDV
AALLAFAIAIQLLLQHSNVDMQLGYLRWIFAWAPVHRFHHMKYGRAGDVNFALFFNLWDW
LLGTGFYTADYEIRQGDLGIGSRPDFPRDYVAQLLDPFGPVSLSKEPSVPEPLRR