Protein Info for Pf1N1B4_340 in Pseudomonas fluorescens FW300-N1B4

Annotation: Alpha-L-Rha alpha-1,3-L-rhamnosyltransferase (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 290 to 306 (17 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 6 to 127 (122 residues), 54.6 bits, see alignment E=1.5e-18 PF00535: Glycos_transf_2" amino acids 10 to 137 (128 residues), 50.2 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 47% identical to RFBG_SHIFL: dTDP-rhamnosyl transferase RfbG (rfbG) from Shigella flexneri

KEGG orthology group: K12991, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 69% identity to pfo:Pfl01_4055)

MetaCyc: 51% identical to dTDP-L-Rha:6-O-acetyl-alpha-D-GlcNAc-PP-Und alpha-(1,3)-rhamnosyltransferase (Escherichia coli O49)
2.4.1.-

Predicted SEED Role

"Alpha-L-Rha alpha-1,3-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MKC7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Pf1N1B4_340 Alpha-L-Rha alpha-1,3-L-rhamnosyltransferase (EC 2.4.1.-) (Pseudomonas fluorescens FW300-N1B4)
MPVKHPKVAVLLAAYNGMQWIEEQLASILDQSAVDVTIYISIDPSTDGTEARCAAYSAEH
HQVIVLPDAGSFGGASRNFFRLIRDVDFGSFDFISFADQDDVWHKDKLQRAVDAIQTRQV
DAYSSNVTAFWPDGRTHLLDKAQPQVEWDYLFEAAGPGCTYVLSKKMAESLKAAMVENWQ
PLQNVTLHDWYCYAFARSHGYRWYIDPLPSMDYRQHERNQVGANKGLSPLIARYKTIHDG
WWFNQVRMIARLVGRDTDPFVKTWLHLRHRQLIKLSFSAWQCRRRARDKVFFFFICWATA
LIGCKAK