Protein Info for Pf1N1B4_3399 in Pseudomonas fluorescens FW300-N1B4

Annotation: RNA polymerase sigma-70 factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF04542: Sigma70_r2" amino acids 14 to 80 (67 residues), 33.2 bits, see alignment E=1.1e-11 PF08281: Sigma70_r4_2" amino acids 113 to 164 (52 residues), 30.9 bits, see alignment 5.1e-11 PF20239: DUF6596" amino acids 182 to 281 (100 residues), 130.5 bits, see alignment E=8.2e-42 PF07719: TPR_2" amino acids 365 to 394 (30 residues), 25.3 bits, see alignment (E = 3.4e-09)

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 89% identity to pba:PSEBR_a1248)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZA45 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Pf1N1B4_3399 RNA polymerase sigma-70 factor, ECF subfamily (Pseudomonas fluorescens FW300-N1B4)
MPGESVRARVEQVYREDSRRILATLIRLLGDFDLAEEALHEAFFVAVERWQRDGVPDNPR
TWLVSTGRFKAIDVLRRRARFNASRPMLIAQLEELEQADWSDEDVEDDRLRLIFTCCHPA
LAADAQVPLTLREVCDLTTEEIARAFLSAPATIAQRIVRAKAKIRDAKIPYQVPTLTELP
ERLDSVLRVIYLVFNEGYSASIGNELTREDLTREAIRLGRLLMELLPEPEVMGLLALMLL
HESRRPARTSSSGELIVLDEQDRSLWDAELIAEGCALVERALTTRRFGPYCLQAAIAAVH
AEAPTAAETDWPQIVGLYDVLLRAVPSPVIELNRAAALAKRDGPLAGLMLIEGILARGEL
LDYHLAHSARAEFYRQLGRVEEARAAYERALELTQQVPERRFIEGRLRALE