Protein Info for Pf1N1B4_339 in Pseudomonas fluorescens FW300-N1B4

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 188 (184 residues), 60 bits, E=7.5e-20
• PF01370: Epimerase
  • amino acids 6 to 226 (221 residues), 104.9 bits, E=1.6e-33
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 309 (303 residues), 59.3 bits, E=1.6e-19
• PF01073: 3Beta_HSD
  • amino acids 7 to 255 (249 residues), 72.1 bits, E=1.4e-23
• PF13460: NAD_binding_10
  • amino acids 10 to 171 (162 residues), 47.7 bits, E=6.3e-16
• PF02719: Polysacc_synt_2
  • amino acids 53 to 254 (202 residues), 31.5 bits, E=3.7e-11
• PF07993: NAD_binding_4
  • amino acids 61 to 174 (114 residues), 52.7 bits, E=1.2e-17

Best Hits

Swiss-Prot: 53% identical to GALE_VIBCL: UDP-glucose 4-epimerase (galE) from Vibrio cholerae

KEGG orthology group: None (inferred from 65% identity to pfo:Pfl01_4054)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A166MKA2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Pf1N1B4_339 UDP-glucose 4-epimerase (EC 5.1.3.2) (Pseudomonas fluorescens FW300-N1B4)
MNAPKILVTGASGFVGEAVVFRLLLDKKFIPIAAARGATRLNGLCTVVPFELTDSKALPN
LNDVQVVIHAAARVHVMNETAVDALTEFRKVNVEGTLRLARRAAESGVKRFIFISSIKVN
GESTVLGKPFKANDFPAPADPYGVSKYEAEEALKQLSLDTGMEVVIIRPPLVYGPGVKAN
FLSMMRWLERGVPLPLGAIKNRRSLVAIGNLVDLINVCISHPEAAGNTFLVSDGEDLSTS
QLLRRMADALGVKPRLLSIPYWVLNLGAFLIGRRDLAQRLCGSLQVDISKAWDTLGWLPV
ISVDEALRHTAEEHHLKLHS