Protein Info for Pf1N1B4_3378 in Pseudomonas fluorescens FW300-N1B4

Annotation: Tricarboxylate transport protein TctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 94 to 123 (30 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details PF07331: TctB" amino acids 23 to 160 (138 residues), 53.8 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 68% identity to pag:PLES_31171)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P9V4 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf1N1B4_3378 Tricarboxylate transport protein TctB (Pseudomonas fluorescens FW300-N1B4)
MSHSSDSPALVGTRWVELGLTLFTTLIGAVVMYGSVEQGIGWGDSGPEPGYFPFYIGLLL
SAASVGNGVLTLVRWQALSLSFVSRSAFKQVLSVFIPIALFVGAMPFTGIYVASACFIAW
FMWRDKVRVKPYGKLAISGVSLGAVLASYLIFALWFKVPLDAGPMGDWIALAGRTFK