Protein Info for Pf1N1B4_3377 in Pseudomonas fluorescens FW300-N1B4

Annotation: Tricarboxylate transport membrane protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 82 (37 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 252 to 280 (29 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 355 to 380 (26 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 411 to 412 (2 residues), see Phobius details amino acids 414 to 443 (30 residues), see Phobius details amino acids 464 to 487 (24 residues), see Phobius details PF01970: TctA" amino acids 21 to 439 (419 residues), 497.6 bits, see alignment E=1.3e-153

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfv:Psefu_3513)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P9U2 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Pf1N1B4_3377 Tricarboxylate transport membrane protein TctA (Pseudomonas fluorescens FW300-N1B4)
MSEFDSLLQGMNLILTPGHIGLMVIGVLLGILVGVLPGLGAPNGVALLLPLTFTMSPVSA
IILLSCMYWGALFGGSITSILFNIPGEPSSVATTFDGYPMAREGRAAEALTAAFSSALIG
ALAGVLLLTFLSTKIAAFAMSFSSPEFFAVYLLAFCTFIGMSKNPPLKTVVAMMIGFAMA
AVGMDTVSGNLRLTFDQPILMTGISFEVAVIGLFGIGEILCTVEEGLVFRGEHARITPMI
ILRTWAKLPRYWWTIVRSTLVGCWMGITPGGPTAASFMSYSLARRFSKNRENFGKGELEG
VIAPETADHAAGTSALLPMLTLGIPGSATAAVMLGGLMIWGLHPGPTLFVEQHDFVWGLI
ASMYLGNVVSLIVVLATVPLFASILRIPFSIIAPIIIMVCAIGAYSVHNSFFDVVLMLGF
GALGYLFKKLGYPIAPLVLAAVLGDKAEDAFRQSMLFSDGHIGIFWSNPLVGGLTTTALL
MLFWPLISKVLQTLLGLRKPHVAKPKSVL