Protein Info for Pf1N1B4_3365 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sialic acid transporter (permease) NanT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 229 to 258 (30 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details amino acids 331 to 357 (27 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details PF07690: MFS_1" amino acids 37 to 291 (255 residues), 130 bits, see alignment E=1e-41 amino acids 283 to 422 (140 residues), 43.3 bits, see alignment E=2.5e-15 PF00083: Sugar_tr" amino acids 64 to 221 (158 residues), 79.3 bits, see alignment E=2.8e-26

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_1404)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P9F5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Pf1N1B4_3365 Sialic acid transporter (permease) NanT (Pseudomonas fluorescens FW300-N1B4)
MSAPDTLVPKATARPGPFDWYHNINKQERRTFWSCKIGYGLDGMDTQMLSFVVPTLIAMW
GITTGEAGLIHTSTLIASAIGGWVAGILSDRIGRVRTLQLTVLWFAFFTFLCGFAQNYEQ
LLISRTLMGFGFGGEWTAGAVLIGEVIRAKDRGKAVGMVQSGWALGWGLTAILYALLFSV
LPPEDAWRALFLLGIVPAIFVIFVRRLVKDPEIYREAKAKQEPSNPAKFYEIFAPGILFT
TIRASILTTGALGGYYAITSWLPTFLKNERGLSVLGTGGYLAMVIVGSYVGYVISAYLTD
ILGRKKNFILFAVGSFTIVLLYTQLPVSNGVMLWLGFPLGFFASGIFSGMGAFLTELFPT
RIRGSGQGFCYNIGRALAALFPLLIGLLSQKVPLSVGIGAFAAVSYGVVILAALSLPETR
GKQLDAQ