Protein Info for Pf1N1B4_3341 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cyanate transport protein CynX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 69 (24 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 346 (319 residues), 103 bits, see alignment E=8.1e-34

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 84% identity to pfl:PFL_1489)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AX08 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Pf1N1B4_3341 Cyanate transport protein CynX (Pseudomonas fluorescens FW300-N1B4)
MENVRATSRPAFWLMFGIILVALNLRPSMAAVGPLLSAIRGDIPLSFSLASLLTMLPVMA
MGLAMFFGIGVSQRLGEQRTVVLSLLIIGLATVSRLFLDSAAELILSAVLAGIGIALIQA
IMPTLIKSRFSDNVSVCMGLYVTSIMGGAAIAASFAPLVMTRTDSWRVGLAIWAALALLA
LLFWCAQRSGMPARDAKSSGKESFFTHSRAWLLAIFFGLGTASYTCVLAWLAPYYVEKGW
SEQQAGLLLGFLTAMEVLSGLLVPAIANRSRDRRLVLVVLLTLIMAGFCGLILSPQYLSL
LWPCLLGLGIGGLFPMSLIVSLDHLDNPQRAGGLTAFVQGIGYLIAGLSPLMAGIIRDQL
GSFEWAWWSLTGVMALMILMALRFDPRHYAKHIH