Protein Info for Pf1N1B4_334 in Pseudomonas fluorescens FW300-N1B4

Annotation: Adenylylsulfate kinase (EC 2.7.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 2 to 172 (171 residues), 246.5 bits, E=7.2e-78
• PF06414: Zeta_toxin
  • amino acids 3 to 46 (44 residues), 23.3 bits, E=7.4e-09
• PF01583: APS_kinase
  • amino acids 6 to 159 (154 residues), 239.5 bits, E=3.2e-75

Best Hits

Swiss-Prot: 66% identical to CYSC_PSEAE: Adenylyl-sulfate kinase (cysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 76% identity to avn:Avin_16180)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A166MK72 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Pf1N1B4_334 Adenylylsulfate kinase (EC 2.7.1.25) (Pseudomonas fluorescens FW300-N1B4)
VKGQKPAVIWLTGLSGAGKSTIANALEQALVEKGRHTFLLDGDNLRMGLCKDLGFADVDR
VENIRRVAEVSKLLVDAGLIVITAFISPFQQDRAMARDVIGPDEFVEVFVDTSLEECERR
DPKGLYGKARAGEIKNFTGIDSAYEAPTNPNIRINTVEEDLAVSVNRVLDYLDKRSAQ