Protein Info for Pf1N1B4_3335 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 3 to 234 (232 residues), 262.3 bits, E=2.7e-82
• PF01259: SAICAR_synt
  • amino acids 7 to 232 (226 residues), 278.2 bits, E=3.3e-87

Best Hits

Swiss-Prot: 98% identical to PUR7_PSEF5: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 97% identity to pfs:PFLU1480)

MetaCyc: 71% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (20/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

See A0A166P8T1 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Pf1N1B4_3335 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (Pseudomonas fluorescens FW300-N1B4)
MEKREELYRGKAKSVYKTDDADRLILLFRNDTSAFDGKRIEQLDRKGMVNNKFNAFIMQK
LEAAGVPTQFDKLLGDNECLVKKLDMIPVECVVRNYAAGSLVKRLGVEEGMKLNPYTFEL
FLKDDAKGDPFINESHVVAFGWGTAEQLVRMKELSLKVNEVLSKLFDDAGLLLVDFKLEF
GVFSDGSIVLGDEFSPDGCRLWDKATGKKMDKDRFRQGLGDVIEAYEEVANRLGVPL