Protein Info for Pf1N1B4_3317 in Pseudomonas fluorescens FW300-N1B4

Annotation: Tricarboxylate transport sensor protein TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 172 to 194 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 19 to 167 (149 residues), 137.3 bits, see alignment E=7.4e-44 PF00672: HAMP" amino acids 192 to 239 (48 residues), 30.2 bits, see alignment 9.3e-11 PF00512: HisKA" amino acids 245 to 309 (65 residues), 56.8 bits, see alignment E=3.9e-19 PF02518: HATPase_c" amino acids 358 to 457 (100 residues), 73.1 bits, see alignment E=5.1e-24

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 95% identity to pfo:Pfl01_1355)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z9W2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Pf1N1B4_3317 Tricarboxylate transport sensor protein TctE (Pseudomonas fluorescens FW300-N1B4)
MHRLSSLRWRLLWNLALLLVVLMLASGLSAYWNGREAADTAYDRTLLASARTIAAGLSQR
DGSLSANVPYVALDTFAYDSAGRIFYLVNDINQKLISGYENLPAPPPGTPRTDDYPALAR
FYNATYQGQNVRVVSLLKAVSEPNMNGMAEIRVAETDEARVRMARSLMADTLLRLGMLAI
GALLLVWFAVSAALRPLERLRTAVEERQPDDLRPLPLVEVQHELGPLVRALNHFTERLRG
QFERQAQFIADAAHELRTPLAALKARLELGLRSNEPDTWRSTLETAAQGTDRLTHLANQL
LSLARVENGARAIAEGGAQLLDLSQLARELGMAMAPLAHARGVALALEADEPVWLRGEPT
LLNELLSNLVDNALAHTPPGGNVILRVMAPAVLEVEDDGPGIPLEERDRVFERFYRRNEQ
VAGSGLGLAIVGEICRAHLAQISLHDGERAGLKVRVSFIAGE