Protein Info for Pf1N1B4_3295 in Pseudomonas fluorescens FW300-N1B4

Annotation: Filamentation induced by cAMP protein Fic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 PF02661: Fic" amino acids 271 to 332 (62 residues), 38.8 bits, see alignment E=7.1e-14

Best Hits

KEGG orthology group: None (inferred from 81% identity to pmy:Pmen_2182)

Predicted SEED Role

"Filamentation induced by cAMP protein Fic"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z9U1 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Pf1N1B4_3295 Filamentation induced by cAMP protein Fic (Pseudomonas fluorescens FW300-N1B4)
MQVGFKALANRYDIALAQPLRVDSMIGTVRVSRESDGNVENRYPASYRPADDFAGHFEFG
LKYEEIHLEFFARLFAAIGPQPVEDWCRREPFGQYARRTGFLYEWLTGERLDVPDVTNGG
YVDVLSPQDYLTRREALRTRRWRVNNNLPGTAGFCPLVRRTAPVQEALQFDLREALDELD
QAFGPDILMRTASWLTFKESRASFLIEKEADQADRIQRFAHVIAQYCGHIKDPLSNDSLH
SLQAGILGRDAIGLGLRRSPVFVGQATMREDIVHYIAPHFADLAQLLAGLNEFEVATRGA
ESLARAAVLAFGFVYIHPMRDGNGRIHRFLINDSLIRDKAVPDGVILPVSATITSSIDFR
AGYDRTLEVFSRPFMRRYAAAYRFGELVTYEDGTRSNFIFDEYEDACFAWRYPDLTEHVL
YTARVVEHTIRKEMADEARVLMIFQRAQEQLKEVLEMPDLDANRIIRSLKENGWVVSGKL
KKGYPQLEDERMAGRVVEAVRSAFEDREMGAGEEGSFGESG