Protein Info for Pf1N1B4_3291 in Pseudomonas fluorescens FW300-N1B4

Annotation: Putative subunit of Alternative cytochrome c oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details PF03626: COX4_pro" amino acids 16 to 85 (70 residues), 50.3 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 81% identity to vap:Vapar_5126)

Predicted SEED Role

"Putative subunit of Alternative cytochrome c oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z5A3 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Pf1N1B4_3291 Putative subunit of Alternative cytochrome c oxidase (Pseudomonas fluorescens FW300-N1B4)
MAHAQGQQHPISLYLKIWGLLFVLSTLSYLVDYFHFHGYLRWSLIITFMLLKAGLIVSIF
MHMAWERLAMVYAILVPPLCLLVLVGLMATEADYVFLSRVISFGQ