Protein Info for Pf1N1B4_3289 in Pseudomonas fluorescens FW300-N1B4

Annotation: Alternative cytochrome c oxidase polypeptide CoxO (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details PF00510: COX3" amino acids 2 to 173 (172 residues), 29.1 bits, see alignment E=4.7e-11

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 43% identity to pol:Bpro_0728)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P7W5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Pf1N1B4_3289 Alternative cytochrome c oxidase polypeptide CoxO (EC 1.9.3.1) (Pseudomonas fluorescens FW300-N1B4)
VGLRLFLVVVSSLFFLFLFAFIARSQMADWLPLTDPLAPLANLWQLWLNSAFLVFSCVAL
QWSRMAARQARLDATIIGFALGGVFAIAFLVGQLWVWQQFVAWGYFVASNPANSFFYLLT
GLHGLHLLGGLIAWSIIVAKFLRRVPLPQLRVSVELCTTYWHYLLGLWFVLFALLASTPQ
TYEAIARFCGLR