Protein Info for Pf1N1B4_3253 in Pseudomonas fluorescens FW300-N1B4

Annotation: Acyl carrier protein phosphodiesterase (EC 3.1.4.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04336: ACP_PD
  • amino acids 81 to 184 (104 residues), 121 bits, E=1.5e-39

Best Hits

Swiss-Prot: 39% identical to ACPH_YERE8: Acyl carrier protein phosphodiesterase (acpH) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_1285)

MetaCyc: 36% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

• acyl carrier protein metabolism (2/2 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

See A0A162BPN6 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Pf1N1B4_3253 Acyl carrier protein phosphodiesterase (EC 3.1.4.14) (Pseudomonas fluorescens FW300-N1B4)
MNYLAHLHLGGQRPGQMLGSLYGDFVKGRLQGQFDPEIEAAIQLHRSIDVFTDRHPLVDI
ALSRFSITRRRYAGIVLDVFFDHCLARDWTLYADQPLEQFTAHVYRVLSAEPQLPERLAR
IAPHMVANDWLGSYQEFEVLEQVLRGISRRLTRPEELAGAMQELRRLYEPLSEDFRLFYP
QLQAFAATPRI