Protein Info for Pf1N1B4_3249 in Pseudomonas fluorescens FW300-N1B4

Annotation: Arginine/ornithine antiporter ArcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details PF00892: EamA" amino acids 16 to 149 (134 residues), 60.5 bits, see alignment E=1e-20 amino acids 159 to 283 (125 residues), 31.2 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfl:PFL_1334)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P6X5 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Pf1N1B4_3249 Arginine/ornithine antiporter ArcD (Pseudomonas fluorescens FW300-N1B4)
MNVNHPGYKGAEQPIKGIALICLAVLLFASHDTLSKYLSGFYPIVMVVWARYVVHTLLML
VIFVPRSGFSVVVRTKRPGLQLLRALCLIGTSLFFTTGLRYIPLAEATAVTFLAPLLVTA
LSVPLLHERVTRNQWLAVLGGFVGVLIVVRPGGALFTPAILLPLCSALCFGFYQLLTRLL
SGIDSPTTSNFLTGILNSLIMTALLPFFWSTPTLLHGLFMIGLGTCGMFGHMLLTQAFRH
AAPAMLAPFSYGQILFAGMYGYLIFDHTPDSFGVIGITVICLSGLAVAWGQRKR