Protein Info for Pf1N1B4_3228 in Pseudomonas fluorescens FW300-N1B4

Annotation: Low-affinity inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 67 (27 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 109 to 125 (17 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details PF01384: PHO4" amino acids 17 to 465 (449 residues), 311.3 bits, see alignment E=4e-97

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 97% identity to pba:PSEBR_a1261)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P6I3 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Pf1N1B4_3228 Low-affinity inorganic phosphate transporter (Pseudomonas fluorescens FW300-N1B4)
VSLLLALAFVLAFEFINGFHDTANAVATVIYTKAMPPHLAVFFSGVFNFLGVLLGGVGVA
YAIVHLLPVELLINVNTGHGLAMVFSLLAAAITWNLGTWYFGIPASSSHTLIGSILGVGL
ANALINDIPLADGVNWQKAIDIGASLVFSPMAGFLIAALVLISLKWWRPLSKMHKTPEQR
RKIDDKKHPPFWNRLVLVISAMAVSFVHGSNDGQKGIGLIMLVLIGIVPAQFVLDLNSTT
YQIERTRDATLHLSQFYERNRESLGEFLALGKSVKGDLPEKFRCNPQQTEPTISALLGTL
KGVADYHSLPSESRIEVRRYLLCLDDTAKKVAKLPGLAAREKADLDKLRKDLTTTTEYAP
FWVILAVALALGLGTMVGWKRVVLTIGEKIGKQGMTYAQGMSAQITTACMIGAANIFSLP
VSTTHVLSSGVAGTMVANKSGLQGGTVRTILLAWVLTLPATVALSAGLFWLASKALGS