Protein Info for Pf1N1B4_3201 in Pseudomonas fluorescens FW300-N1B4

Annotation: Colicin E3 (EC 3.1.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 140 to 148 (9 residues), see Phobius details amino acids 151 to 163 (13 residues), see Phobius details PF06958: Pyocin_S" amino acids 175 to 305 (131 residues), 98.3 bits, see alignment E=5.6e-32 PF09000: Cytotoxic" amino acids 323 to 404 (82 residues), 102.4 bits, see alignment E=1.4e-33

Best Hits

KEGG orthology group: None (inferred from 69% identity to pfo:Pfl01_1233)

Predicted SEED Role

"Colicin E3 (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z9K7 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Pf1N1B4_3201 Colicin E3 (EC 3.1.-.-) (Pseudomonas fluorescens FW300-N1B4)
VAGHKDIPRVKNPPSGDGHHVTHRYMTATELAERDARQNAYDAMLARQQAFEDSLQVAAK
KGNVVRAGCVFAKSCKLPDAIIDYTNPSGVVPTDSLKDYGELVLLGAREADESGVVPLKK
ISGTAIPAGFGSFALAGSAFTALPAVAASTATATLAGLVALVIPSSLGDSSLYTEDQLRA
LKQARTRVRLRVEQQADGSLKGYGFYTGKNRDWEMVDVVQFTLRGSQQVADLGDGIELIW
TPAEDGSNILGIPALEAAPQAPHIWVYPPTKAADSIIVNPVYPPEYKDFILVFPADSGVL
PVYIVVSVAGRRVPNPDHDYHSAPETEEITGFLGLKEAKKKNPRQGGGGLRERWIDAKGR
TIYEWDSLHGELEAYRASDGSHLGSFDHLTGKQIDPPKKNRSIKKYL