Protein Info for Pf1N1B4_3184 in Pseudomonas fluorescens FW300-N1B4

Annotation: Isochorismatase (EC 3.3.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to YRDC_BACSU: Uncharacterized isochorismatase family protein YrdC (yrdC) from Bacillus subtilis (strain 168)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 85% identity to pfo:Pfl01_1215)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

superpathway of chorismate metabolism (42/59 steps found)
2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
enterobactin biosynthesis (4/11 steps found)
vibriobactin biosynthesis (1/9 steps found)
bacillibactin biosynthesis (3/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P5S2 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Pf1N1B4_3184 Isochorismatase (EC 3.3.2.1) (Pseudomonas fluorescens FW300-N1B4)
MELKTNAALIIIDQQKGILHPRLGRRNNPQAEERILELLGHWRRTGRPVIHVQHLSRSED
SVFWPQQSGVEFQERFQPSMGEWLIQKQVPDAFCSTGLEARLREAGIDQLIIVGVATNNS
VESTARTAGNLGFEAWVAEDACFTFDKTDYFGDAHSAEEVHAMSLGNLHGEYATVISTAK
ILHAD