Protein Info for Pf1N1B4_3143 in Pseudomonas fluorescens FW300-N1B4
Annotation: RecA protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to RECA_PSEPF: Protein RecA (recA) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: K03553, recombination protein RecA (inferred from 98% identity to pfo:Pfl01_1175)MetaCyc: 74% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A166P532 at UniProt or InterPro
Protein Sequence (350 amino acids)
>Pf1N1B4_3143 RecA protein (Pseudomonas fluorescens FW300-N1B4) MDDNKKKALAAALGQIERQFGKGAVMRMGDQDRQAIPAISTGSLGLDIALGIGGLPKGRI VEIYGPESSGKTTLTLSVIAQAQKAGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDT GEQALEITDMLVRSNAVDVIIVDSVAALVPKAEIEGEMGDMHVGLQARLMSQALRKITGN IKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSE TRVKVVKNKVASPFRQAEFQILYGKGIYLNGEMIDLGVLHGFVEKSGAWYAYEGTKIGQG KANSAKFLADNPEIAAKLEKQLRDKLLSPAPDVKASPVKETADDLADADI