Protein Info for Pf1N1B4_3078 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG138056: a glutathione-dependent thiol reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01617: transcriptional regulator, Spx/MgsR family
  • amino acids 8 to 116 (109 residues), 98.9 bits, E=1.1e-32
• PF03960: ArsC
  • amino acids 11 to 117 (107 residues), 77 bits, E=5.7e-26

Best Hits

Swiss-Prot: 46% identical to YFFB_ECOLI: Protein YffB (yffB) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 93% identity to pfl:PFL_1171)

Predicted SEED Role

"FIG138056: a glutathione-dependent thiol reductase"

MetaCyc Pathways

• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See A0A162AWF6 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Pf1N1B4_3078 FIG138056: a glutathione-dependent thiol reductase (Pseudomonas fluorescens FW300-N1B4)
LTASSKTLHLFGIKACDTMKKARTWLDEHAVSYDFHDYKTVGIDREHLSQWCDEHGWQVV
LNRAGTTFRKLDDERKADLDQRKAIELMLAQPSMIKRPVLDLGDRTLIGFKPDIYAAALK