Protein Info for Pf1N1B4_3075 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF02657: SufE" amino acids 12 to 131 (120 residues), 141.6 bits, see alignment E=5.3e-46

Best Hits

Swiss-Prot: 39% identical to YA00_RHIME: Uncharacterized SufE-like protein R01000 (R01000) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 81% identity to pfl:PFL_1168)

MetaCyc: 43% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BPA2 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Pf1N1B4_3075 Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE (Pseudomonas fluorescens FW300-N1B4)
MTLPADAVTALDTFQQAASWEQRARLLMQWGDRLPPLSDVDKVEANRVHGCESQVWLVGT
LQDGHWQFSASSDARLIRGLVALLLARVNGLSAVELQQVDLADWFNQLGLGRQLSQSRSN
GLNAVLQRMRELAA