Protein Info for Pf1N1B4_3025 in Pseudomonas fluorescens FW300-N1B4

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 210 to 212 (3 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 250 (166 residues), 41.6 bits, see alignment E=5.7e-15

Best Hits

Swiss-Prot: 78% identical to YDCV_SHIFL: Inner membrane ABC transporter permease protein YdcV (ydcV) from Shigella flexneri

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 95% identity to pfo:Pfl01_1045)

MetaCyc: 78% identical to putative ABC transporter membrane subunit YdcV (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z4Q6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Pf1N1B4_3025 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Pseudomonas fluorescens FW300-N1B4)
MRSDTSSQDRASLGLRIAAWGGLVFLHFPILIIFLYAFNTEDAAFSFPPKGFTLKWIGVA
FSRPDVLEAIKLSLQIAAVATLIALILGTLASAALYRRDFFGKQGISLMLILPIALPGII
TGIALLATFKTLGIEPGMFTIIVGHATFCVVIVYNNVIARLRRTSYSLIEASMDLGADGW
QTFRYIVLPNLGSAMLAGGMLAFALSFDEIIVTTFTAGHERTLPLWLLNQLSRPRDVPVT
NVVAMLVMMVTMLPILGAYYLTRGGESVAGSGGK