Protein Info for Pf1N1B4_2989 in Pseudomonas fluorescens FW300-N1B4

Annotation: NAD-dependent formate dehydrogenase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 200 to 221 (22 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details PF01512: Complex1_51K" amino acids 146 to 316 (171 residues), 151 bits, see alignment E=2.5e-48 PF10589: NADH_4Fe-4S" amino acids 428 to 511 (84 residues), 85.2 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 88% identity to pfl:PFL_0330)

Predicted SEED Role

"NAD-dependent formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QIS8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Pf1N1B4_2989 NAD-dependent formate dehydrogenase beta subunit (Pseudomonas fluorescens FW300-N1B4)
MMPRLYLPCDSLARAVGADEVSVALATQARERNLPLDLQRTSSRGLYWLEPLLEVDSPQG
RIGFGPLTAADVPSVLDALQGEPSAHPLALGLVEELPYLKTQQRLLFARAGITQPLSLED
YRAHGGFEGLTQAIALGGEQTATAVFDSGLRGRGGAAFPAGIKWRTVRGTQAAQKYIVCN
ADEGDSGTFADRMLMEGDPFLLIEGMAIAGITVGATYGYIYVRSEYPDAVATLRAALNIA
RSAGYLGANVGGSGQAFDMEVRVGAGAYICGEETALLDSLEGKRGIVRAKPPIPALQGLF
GLPTLVHNVLTLASVPLILAKGAQFYRDYGMGRSLGTMPFQLAGNIRHGGLVERAFGLTL
RELVEDYGGGTASGRPLKAAQVGGPLGAWVPPAQFDTPLDYEAFAAIGAMLGHGGVVVAD
DTLDMAHMARFAMQFCAEESCGKCTPCRIGSTRGVEVIDRLLAAPDQNSRDEQVIILKDL
CDTLQYGSLCALGGMTSYPVASALKYFPADFGLQSSEADQ